RECHARGED
A Battery's Second Life
AI-Generated Commercial for Runway Big Ad Contest 2026
THE BRIEF
Runway's Big Ad Contest challenged creators to produce a short commercial for a fictional rechargeable battery brand — using only AI tools on the Runway ML platform.
THE CONCEPT
What if a battery could outlive the life it was part of? "Recharged" follows a single AA battery through a decade of someone's life — from a hopeful purchase to a quiet divorce. Packed into a cardboard box it ends up at a garage sale. A stranger takes it home. Click — it still works. A story about second chances, told through a thing that was designed for them.
STYLE DIRECTION
Wes Anderson's signature aesthetic — symmetrical framing, pastel palettes, deadpan warmth, and meticulous set design — felt like the perfect match for a story that finds beauty in small, overlooked objects. Every frame is built around centered composition, muted tones, and quiet emotional beats.
PRODUCT DESIGN
The rechargeable AA battery uses a bold four-stripe color scheme — green, dark blue, white, and orange — designed to stand out in every frame and feel distinctly retro yet modern.
PACKAGING
A silver metallic tin with a technical "Battery Operational Schematic" engraved on the lid. Wrapped with a colorful striped band matching the battery's palette. The packaging feels like a collectible — something you'd keep, not throw away. The design mirrors the film's core message: this is a product built to last, built to be kept, built for more than one life.
STORYBOARD V1
01 — The Purchase. A cashier stamps the battery box. 2014.
02 — First Home. A couple on a pastel couch, remote in hand.
03 — Family Life. Kids on the floor, toys everywhere. The remote still works.
04 — The End. A meteorite in the backyard. Things fall apart.
05 — Packing Up. He puts the battery in a box labeled "STUFF."
06 — Garage Sale. The box sits on a table marked "FREE". She takes it.
07 — New Beginning. She unpacks. Finds the battery. Puts it in a remote. Click — the TV turns on.
08 — Packshot. The camera dives into the screen. The battery spins on a vinyl record.
02 — First Home. A couple on a pastel couch, remote in hand.
03 — Family Life. Kids on the floor, toys everywhere. The remote still works.
04 — The End. A meteorite in the backyard. Things fall apart.
05 — Packing Up. He puts the battery in a box labeled "STUFF."
06 — Garage Sale. The box sits on a table marked "FREE". She takes it.
07 — New Beginning. She unpacks. Finds the battery. Puts it in a remote. Click — the TV turns on.
08 — Packshot. The camera dives into the screen. The battery spins on a vinyl record.
AI WORKFLOW
1. SCRIPT & STORYBOARD
Written and visualized scene by scene before any
generation began.
Written and visualized scene by scene before any
generation began.
2. IMAGE GENERATION — NANOBANANA 2
Each frame started as a detailed text prompt on the Runway ML platform. Key challenges:
- Character consistency across scenes
- Maintaining Wes Anderson's symmetrical style
- Matching color palette and lighting throughout
- Product accuracy (battery design, packaging)
Each frame started as a detailed text prompt on the Runway ML platform. Key challenges:
- Character consistency across scenes
- Maintaining Wes Anderson's symmetrical style
- Matching color palette and lighting throughout
- Product accuracy (battery design, packaging)
3. VIDEO ANIMATION — KLING
Static frames were animated using Kling's
image-to-video pipeline:
- Start frame / end frame technique for transitions
- Camera controls: static, tilt, zoom, orbit
- Motion intensity tuned per scene
- 5-second clips assembled in sequence
Static frames were animated using Kling's
image-to-video pipeline:
- Start frame / end frame technique for transitions
- Camera controls: static, tilt, zoom, orbit
- Motion intensity tuned per scene
- 5-second clips assembled in sequence
4. MUSIC
Music created on Suno AI platform.
Music created on Suno AI platform.
5. POST-PRODUCTION
Final assembly, color grading, green screen
compositing, text overlays, and sound design.
Final assembly, color grading, green screen
compositing, text overlays, and sound design.
ITERATIONS
Not every generation was perfect on the first try. Some key frames required 10-20 iterations to achieve the right composition, lighting, and emotional tone. The AI workflow demands patience and precision in prompt crafting — much like directing real actors
on a real set.
on a real set.
THE FINAL FILM
Some things outlast everything. A rechargeable battery is one of them.
Thanks for watching! I would be grateful for your Like and Comment!
aıcommercialAdvertising animation batterypastelsymmetryfilmmakingbranding motion